PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G07010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 301aa    MW: 32244.8 Da    PI: 7.4984
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G07010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.82.2e-2487130144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCsr++++ +k+CE+H+hrg++rsrk++e
  OGLUM06G07010.1  87 DPEPGRCRRTDGKKWRCSREAYGESKYCEKHMHRGKNRSRKPVE 130
                      79***************************************997 PP

2QLQ62.61e-211145236
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                      FTa+Q+q+L++Q+l+yKy+aa++PvPp+Ll++++
  OGLUM06G07010.1 11 LFTATQWQELEHQALIYKYMAAGAPVPPDLLLHLR 45
                     5******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-101046IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.0391146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.0E-161244IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.71487131IPR014977WRC domain
PfamPF088791.5E-1988130IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MMAGGGSGRC LFTATQWQEL EHQALIYKYM AAGAPVPPDL LLHLRHRAAA AAAADVDTVP  60
SLAFPPHHLG WGCYGAAAAQ YGRRVEDPEP GRCRRTDGKK WRCSREAYGE SKYCEKHMHR  120
GKNRSRKPVE MPPPAAASVY RPSALSISPP PHDADAPSYG AGAGAPLQLH LDSFHASTSP  180
PPSYHRYAHT SSAPLFPSSA AGYGGGWSLS KEHCLTLGGA AADLSLDEPA DHHHDATSAT  240
TEKPLRRFFD EWPRSDDGRT PWDGTQLSIS IPTAAAASPD LAIAGAASRY HSNGDHLRTS  300
E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8361980.0CT836198.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA059E01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641768.10.0PREDICTED: growth-regulating factor 2
SwissprotQ6AWY70.0GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLA0A0E0A6H40.0A0A0E0A6H4_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g10310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-42growth-regulating factor 5